Lineage for d1vdxa_ (1vdx A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655733Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 1655734Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 1655778Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 1655779Protein automated matches [190796] (4 species)
    not a true protein
  7. 1655786Species Pyrococcus horikoshii [TaxId:53953] [188054] (2 PDB entries)
  8. 1655788Domain d1vdxa_: 1vdx A: [161850]
    automated match to d1iuha_
    complexed with cl

Details for d1vdxa_

PDB Entry: 1vdx (more details), 2.4 Å

PDB Description: Crystal Structure of a Pyrococcus horikoshii protein with similarities to 2'5' RNA-ligase
PDB Compounds: (A:) Hypothetical protein PH0099

SCOPe Domain Sequences for d1vdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdxa_ d.61.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
else

SCOPe Domain Coordinates for d1vdxa_:

Click to download the PDB-style file with coordinates for d1vdxa_.
(The format of our PDB-style files is described here.)

Timeline for d1vdxa_: