Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (24 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188050] (1 PDB entry) |
Domain d1vbjb_: 1vbj B: [161840] automated match to d1vp5a_ complexed with cit, nap |
PDB Entry: 1vbj (more details), 2.1 Å
SCOPe Domain Sequences for d1vbjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbjb_ c.1.7.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} pefmaltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiyknees agraiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkdkf idtwkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalceyc kskniavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgneari kengnifdfeltaediqvidgmnaghrygpdpevfmndf
Timeline for d1vbjb_: