Lineage for d1vbjb_ (1vbj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1818041Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 1818042Protein automated matches [190793] (24 species)
    not a true protein
  7. 1818153Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188050] (1 PDB entry)
  8. 1818155Domain d1vbjb_: 1vbj B: [161840]
    automated match to d1vp5a_
    complexed with cit, nap

Details for d1vbjb_

PDB Entry: 1vbj (more details), 2.1 Å

PDB Description: the crystal structure of prostaglandin f synthase from trypanosoma brucei
PDB Compounds: (B:) prostaglandin F synthase

SCOPe Domain Sequences for d1vbjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbjb_ c.1.7.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
pefmaltqslklsngvmmpvlgfgmwklqdgneaetatmwaiksgyrhidtaaiyknees
agraiascgvpreelfvttklwnsdqgyestlsafeksikklgleyvdlylihwpgkdkf
idtwkafeklyadkkvraigvsnfhehhieellkhckvapmvnqielhpllnqkalceyc
kskniavtawsplgqghlvedarlkaiggkygktaaqvmlrweiqagvitipksgneari
kengnifdfeltaediqvidgmnaghrygpdpevfmndf

SCOPe Domain Coordinates for d1vbjb_:

Click to download the PDB-style file with coordinates for d1vbjb_.
(The format of our PDB-style files is described here.)

Timeline for d1vbjb_: