Lineage for d1fbub_ (1fbu B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45698Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)
  6. 45699Protein Heat-shock transcription factor [46874] (2 species)
  7. 45703Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (6 PDB entries)
  8. 45707Domain d1fbub_: 1fbu B: [16177]

Details for d1fbub_

PDB Entry: 1fbu (more details), 2 Å

PDB Description: heat shock transcription factor dna binding domain

SCOP Domain Sequences for d1fbub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbub_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha

SCOP Domain Coordinates for d1fbub_:

Click to download the PDB-style file with coordinates for d1fbub_.
(The format of our PDB-style files is described here.)

Timeline for d1fbub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fbua_