PDB entry 1fbu

View 1fbu on RCSB PDB site
Description: heat shock transcription factor dna binding domain
Deposited on 2000-07-16, released 2001-01-10
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fbua_
  • Chain 'B':
    Domains in SCOP 1.57: d1fbub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbuA (A:)
    pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
    ygwhkvqdvksgsmlsnndsrwefenerh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbuB (B:)
    pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
    ygwhkvqdvksgsmlsnndsrwefenerha