Class a: All alpha proteins [46456] (289 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (2 species) |
Species Influenza B virus [TaxId:11520] [140389] (1 PDB entry) Uniprot P03502 15-103 |
Domain d1xeqb_: 1xeq B: [161361] automated match to d1xeqa1 complexed with br |
PDB Entry: 1xeq (more details), 2.1 Å
SCOPe Domain Sequences for d1xeqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeqb_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza B virus [TaxId: 11520]} qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe nkrmsleerkaigvkmmkvllfmdp
Timeline for d1xeqb_: