Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (11 species) not a true protein |
Species Human immunodeficiency virus [TaxId:12721] [188065] (4 PDB entries) |
Domain d1w5xb_: 1w5x B: [161358] Other proteins in same PDB: d1w5xa_ automated match to d1ajva_ complexed with be5 |
PDB Entry: 1w5x (more details), 1.9 Å
SCOPe Domain Sequences for d1w5xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5xb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d1w5xb_: