Lineage for d1a5ja2 (1a5j A:56-110)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305482Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2305486Protein b-Myb DNA binding domain [46743] (1 species)
  7. 2305487Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry)
  8. 2305489Domain d1a5ja2: 1a5j A:56-110 [16044]
    repeats 2 & 3

Details for d1a5ja2

PDB Entry: 1a5j (more details)

PDB Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures
PDB Compounds: (A:) b-myb

SCOPe Domain Sequences for d1a5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ja2 a.4.1.3 (A:56-110) b-Myb DNA binding domain {Chicken (Gallus gallus) [TaxId: 9031]}
evkksswteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt

SCOPe Domain Coordinates for d1a5ja2:

Click to download the PDB-style file with coordinates for d1a5ja2.
(The format of our PDB-style files is described here.)

Timeline for d1a5ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5ja1