Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein c-Myb, DNA-binding domain [46740] (1 species) duplication |
Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries) |
Domain d1msfc1: 1msf C:89-143 [16041] repeats 2 & 3 protein/DNA complex |
PDB Entry: 1msf (more details)
SCOPe Domain Sequences for d1msfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msfc1 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk
Timeline for d1msfc1: