Lineage for d1vnd__ (1vnd -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 532782Family a.4.1.1: Homeodomain [46690] (28 proteins)
    Pfam 00046
  6. 532914Protein VND/NK-2 protein [46724] (1 species)
  7. 532915Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 532917Domain d1vnd__: 1vnd - [16014]

Details for d1vnd__

PDB Entry: 1vnd (more details)

PDB Description: vnd/nk-2 protein (homeodomain), nmr

SCOP Domain Sequences for d1vnd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vnd__ a.4.1.1 (-) VND/NK-2 protein {Fruit fly (Drosophila melanogaster)}
asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
ryktkraqnekgyeghp

SCOP Domain Coordinates for d1vnd__:

Click to download the PDB-style file with coordinates for d1vnd__.
(The format of our PDB-style files is described here.)

Timeline for d1vnd__: