Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein VND/NK-2 protein [46724] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries) |
Domain d1vnda_: 1vnd A: [16014] |
PDB Entry: 1vnd (more details)
SCOPe Domain Sequences for d1vnda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh ryktkraqnekgyeghp
Timeline for d1vnda_: