Lineage for d1vnd__ (1vnd -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438101Family a.4.1.1: Homeodomain [46690] (23 proteins)
  6. 438224Protein VND/NK-2 protein [46724] (1 species)
  7. 438225Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 438226Domain d1vnd__: 1vnd - [16014]

Details for d1vnd__

PDB Entry: 1vnd (more details)

PDB Description: vnd/nk-2 protein (homeodomain), nmr

SCOP Domain Sequences for d1vnd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vnd__ a.4.1.1 (-) VND/NK-2 protein {Fruit fly (Drosophila melanogaster)}
asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
ryktkraqnekgyeghp

SCOP Domain Coordinates for d1vnd__:

Click to download the PDB-style file with coordinates for d1vnd__.
(The format of our PDB-style files is described here.)

Timeline for d1vnd__: