SCOPe 2.03: Domain d9antb_: 9ant B:

Lineage for d9antb_ (9ant B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Antennapedia Homeodomain [46716] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)

8. Domain d9antb_: 9ant B: [16005]
   protein/DNA complex; complexed with ni

Details for d9antb_

PDB Entry: 9ant, 2.4 Å

PDB Description: antennapedia homeodomain-dna complex

PDB Compounds: (B:) antennapedia homeodomain

SCOPe Domain Sequences for d9antb_:

Sequence; same for both SEQRES and ATOM records:

>d9antb_ a.4.1.1 (B:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken

Timeline for d9antb_:

• d9antb_ first appeared (with stable ids) in SCOP 1.55
  
• d9antb_ appears in SCOPe 2.02
  
• d9antb_ appears in SCOPe 2.04
  
• d9antb_ appears in the current release, SCOPe 2.08