Lineage for d9antb_ (9ant B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1226Protein Antennapedia Homeodomain [46716] (1 species)
  7. 1227Species Drosophila melanogaster [TaxId:7227] [46717] (5 PDB entries)
  8. 1229Domain d9antb_: 9ant B: [16005]

Details for d9antb_

PDB Entry: 9ant (more details), 2.4 Å

PDB Description: antennapedia homeodomain-dna complex

SCOP Domain Sequences for d9antb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d9antb_ a.4.1.1 (B:) Antennapedia Homeodomain {Drosophila melanogaster}
rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken

SCOP Domain Coordinates for d9antb_:

Click to download the PDB-style file with coordinates for d9antb_.
(The format of our PDB-style files is described here.)

Timeline for d9antb_:

1229
d9antb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d9anta_