PDB entry 9ant

View 9ant on RCSB PDB site
Description: antennapedia homeodomain-dna complex
Deposited on 1998-07-02, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d9anta_
  • Chain 'B':
    Domains in SCOP 1.55: d9antb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9antA (A:)
    rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9antB (B:)
    rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken