Lineage for d1hddd_ (1hdd D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1078589Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1078601Protein Engrailed Homeodomain [46691] (1 species)
  7. 1078602Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 1078623Domain d1hddd_: 1hdd D: [15979]
    protein/DNA complex

Details for d1hddd_

PDB Entry: 1hdd (more details), 2.8 Å

PDB Description: crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
PDB Compounds: (D:) protein (engrailed homeodomain)

SCOPe Domain Sequences for d1hddd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hddd_ a.4.1.1 (D:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks

SCOPe Domain Coordinates for d1hddd_:

Click to download the PDB-style file with coordinates for d1hddd_.
(The format of our PDB-style files is described here.)

Timeline for d1hddd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hddc_