Lineage for d1be3d2 (1be3 D:1-195)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) Protein Cytochrome bc1 domain [46677] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [46678] (3 PDB entries) 
Domain d1be3d2: 1be3 D:1-195 [15955]
Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c1, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1
Details for d1be3d2
PDB Entry: 1be3 (more details), 3 Å
PDB Description: cytochrome bc1 complex from bovine
SCOP Domain Sequences for d1be3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3d2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae
SCOP Domain Coordinates for d1be3d2:
Click to download the PDB-style file with coordinates for d1be3d2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1be3d2:
View in 3D
