Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species) the C-terminal domain is a 8-bladed beta-propeller |
Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries) |
Domain d1qksa1: 1qks A:9-135 [15951] Other proteins in same PDB: d1qksa2, d1qksb2 complexed with dhe, gol, hec, so4 |
PDB Entry: 1qks (more details), 1.28 Å
SCOPe Domain Sequences for d1qksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qksa1 a.3.1.2 (A:9-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll ldpaapp
Timeline for d1qksa1: