SCOPe 2.08: Domain d1qksa1: 1qks A:9-135

Lineage for d1qksa1 (1qks A:9-135)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries)

8. Domain d1qksa1: 1qks A:9-135 [15951]
   Other proteins in same PDB: d1qksa2, d1qksb2
   complexed with dhe, gol, hec, so4

Details for d1qksa1

PDB Entry: 1qks, 1.28 Å

PDB Description: cytochrome cd1 nitrite reductase, oxidised form

PDB Compounds: (A:) cytochrome cd1 nitrite reductase

SCOPe Domain Sequences for d1qksa1:

Sequence; same for both SEQRES and ATOM records:

>d1qksa1 a.3.1.2 (A:9-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
ldpaapp

Timeline for d1qksa1:

• d1qksa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qksa1 appears in SCOPe 2.07