SCOPe 2.01: Domain d1aoqa1: 1aoq A:17-133

Lineage for d1aoqa1 (1aoq A:17-133)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1aoqa1: 1aoq A:17-133 [15934]
   Other proteins in same PDB: d1aoqa2, d1aoqb2
   complexed with 2no, dhe, hem, no

Details for d1aoqa1

PDB Entry: 1aoq, 1.8 Å

PDB Description: cytochrome cd1 nitrite reductase with substrate and product bound

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1aoqa1:

Sequence; same for both SEQRES and ATOM records:

>d1aoqa1 a.3.1.2 (A:17-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
hktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkga
tgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaa

Timeline for d1aoqa1:

• d1aoqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1aoqa1 appears in SCOP 1.75
  
• d1aoqa1 appears in SCOPe 2.02
  
• d1aoqa1 appears in the current release, SCOPe 2.08