Lineage for d1cry__ (1cry -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Rhodopseudomonas viridis [TaxId:1079] [46654] (3 PDB entries) 
Domain d1cry__: 1cry - [15895]
Details for d1cry__
PDB Entry: 1cry (more details), 3 Å
PDB Description: application of an automatic molecular replacement procedure to crystal structure of cytochrome c2 from rhodopseudomonas viridis
SCOP Domain Sequences for d1cry__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cry__ a.3.1.1 (-) Cytochrome c2 {Rhodopseudomonas viridis}
qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk
SCOP Domain Coordinates for d1cry__:
Click to download the PDB-style file with coordinates for d1cry__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cry__:
- d1cry__ first appeared (with stable ids) in SCOP 1.55
- d1cry__ appears in SCOP 1.59
- d1cry__ appears in the current release, SCOPe 2.08, called d1crya_
View in 3D