Lineage for d3egvb1 (3egv B:2-70)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025228Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 1025229Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 1025230Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 1025234Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 1025277Species Thermus thermophilus [TaxId:274] [160200] (13 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 1025280Domain d3egvb1: 3egv B:2-70 [158149]
    Other proteins in same PDB: d3egva1
    protein/RNA complex; complexed with 4mm, cl, gol, iod, sah

Details for d3egvb1

PDB Entry: 3egv (more details), 1.75 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3egvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3egvb1 d.47.1.1 (B:2-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagaatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfvtk

SCOPe Domain Coordinates for d3egvb1:

Click to download the PDB-style file with coordinates for d3egvb1.
(The format of our PDB-style files is described here.)

Timeline for d3egvb1: