Lineage for d3eg5a_ (3eg5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474974Protein CDC42 [52619] (2 species)
  7. 2475025Species Mouse (Mus musculus) [TaxId:10090] [159559] (2 PDB entries)
  8. 2475026Domain d3eg5a_: 3eg5 A: [158146]
    Other proteins in same PDB: d3eg5b_, d3eg5d_
    automated match to d1ajea_
    complexed with gnp, mg

Details for d3eg5a_

PDB Entry: 3eg5 (more details), 2.7 Å

PDB Description: crystal structure of mdia1-tsh gbd-fh3 in complex with cdc42-gmppnp
PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d3eg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eg5a_ c.37.1.8 (A:) CDC42 {Mouse (Mus musculus) [TaxId: 10090]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale

SCOPe Domain Coordinates for d3eg5a_:

Click to download the PDB-style file with coordinates for d3eg5a_.
(The format of our PDB-style files is described here.)

Timeline for d3eg5a_: