SCOP 1.75: Domain d3eg5a1: 3eg5 A:2-177

Lineage for d3eg5a1 (3eg5 A:2-177)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Mus musculus [TaxId:10090] [159559] (1 PDB entry)

8. Domain d3eg5a1: 3eg5 A:2-177 [158146]
   automatically matched to d1am4d_
   complexed with gnp, mg; mutant

Details for d3eg5a1

PDB Entry: 3eg5, 2.7 Å

PDB Description: crystal structure of mdia1-tsh gbd-fh3 in complex with cdc42-gmppnp

PDB Compounds: (A:) Cell division control protein 42 homolog

SCOP Domain Sequences for d3eg5a1:

Sequence; same for both SEQRES and ATOM records:

>d3eg5a1 c.37.1.8 (A:2-177) CDC42 {Mus musculus [TaxId: 10090]}
qtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagq
edydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrd
dpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Timeline for d3eg5a1:

• d3eg5a1 is new in SCOP 1.75
  
• d3eg5a1 is called d3eg5a_ in SCOPe 2.01
  
• d3eg5a1 appears in the current release, SCOPe 2.08, called d3eg5a_