Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species) |
Species Human immunodeficiency virus type 2 (isolate rod) [TaxId:11720] [187235] (3 PDB entries) |
Domain d3ec0a_: 3ec0 A: [158090] automated match to d1hiia_ complexed with cl, grl, imd, na, zn |
PDB Entry: 3ec0 (more details), 1.18 Å
SCOPe Domain Sequences for d3ec0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ec0a_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 (isolate rod) [TaxId: 11720]} pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk nveievlnkkvratimtgdtpinifgrniltalgmslnl
Timeline for d3ec0a_: