Lineage for d3ec0a_ (3ec0 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1797267Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)
  7. 1797268Species Human immunodeficiency virus type 2 (isolate rod) [TaxId:11720] [187235] (3 PDB entries)
  8. 1797273Domain d3ec0a_: 3ec0 A: [158090]
    automated match to d1hiia_
    complexed with cl, grl, imd, na, zn

Details for d3ec0a_

PDB Entry: 3ec0 (more details), 1.18 Å

PDB Description: High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ec0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ec0a_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 (isolate rod) [TaxId: 11720]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOPe Domain Coordinates for d3ec0a_:

Click to download the PDB-style file with coordinates for d3ec0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ec0a_: