Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins) |
Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (4 PDB entries) Uniprot P33334 1833-2087! Uniprot P33334 1835-2087 |
Domain d3e9pb_: 3e9p B: [158071] automated match to d3e66a1 |
PDB Entry: 3e9p (more details), 2.1 Å
SCOPe Domain Sequences for d3e9pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9pb_ c.55.3.14 (B:) Pre-mRNA-splicing factor 8, Prp8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis altqteikdiilgqn
Timeline for d3e9pb_: