SCOPe 2.01: Domain d3e9pa_: 3e9p A:

Lineage for d3e9pa_ (3e9p A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)

6. Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (3 PDB entries)
   Uniprot P33334 1833-2087! Uniprot P33334 1835-2087

8. Domain d3e9pa_: 3e9p A: [158070]
   automated match to d3e66a1

Details for d3e9pa_

PDB Entry: 3e9p, 2.1 Å

PDB Description: Crystal Structure of Yeast Prp8, Residues 1827-2092

PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d3e9pa_:

Sequence; same for both SEQRES and ATOM records:

>d3e9pa_ c.55.3.14 (A:) Pre-mRNA-splicing factor 8, Prp8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
altqteikdiilgqn

Timeline for d3e9pa_:

• d3e9pa_ first appeared in SCOP 1.75, called d3e9pa1
  
• d3e9pa_ appears in SCOPe 2.02
  
• d3e9pa_ appears in the current release, SCOPe 2.08