SCOPe 2.04: Domain d3e7gc_: 3e7g C:

Lineage for d3e7gc_ (3e7g C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187302] (6 PDB entries)

8. Domain d3e7gc_: 3e7g C: [158050]
   automated match to d1jwja_
   complexed with at2, h4b, hem, zn

Details for d3e7gc_

PDB Entry: 3e7g, 2.2 Å

PDB Description: structure of human inosox with inhibitor ar-c95791

PDB Compounds: (C:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3e7gc_:

Sequence; same for both SEQRES and ATOM records:

>d3e7gc_ d.174.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
dek

Timeline for d3e7gc_:

• d3e7gc_ first appeared in SCOP 1.75, called d3e7gc1
  
• d3e7gc_ appears in SCOPe 2.03
  
• d3e7gc_ appears in SCOPe 2.05
  
• d3e7gc_ appears in the current release, SCOPe 2.08