SCOP 1.75: Domain d3e7gc1: 3e7g C:83-502

Lineage for d3e7gc1 (3e7g C:83-502)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56516] (11 PDB entries)

8. Domain d3e7gc1: 3e7g C:83-502 [158050]
   automatically matched to d1nsia_
   complexed with at2, h4b, hem, zn

Details for d3e7gc1

PDB Entry: 3e7g, 2.2 Å

PDB Description: structure of human inosox with inhibitor ar-c95791

PDB Compounds: (C:) Nitric oxide synthase, inducible

SCOP Domain Sequences for d3e7gc1:

Sequence; same for both SEQRES and ATOM records:

>d3e7gc1 d.174.1.1 (C:83-502) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

Timeline for d3e7gc1:

• d3e7gc1 is new in SCOP 1.75
  
• d3e7gc1 is called d3e7gc_ in SCOPe 2.01
  
• d3e7gc1 appears in the current release, SCOPe 2.08, called d3e7gc_