Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187302] (35 PDB entries) |
Domain d3e7ga_: 3e7g A: [158048] automated match to d1jwja_ complexed with at2, h4b, hem, zn |
PDB Entry: 3e7g (more details), 2.2 Å
SCOPe Domain Sequences for d3e7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7ga_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq d
Timeline for d3e7ga_: