SCOPe 2.06: Domain d3e47i_: 3e47 I:

Lineage for d3e47i_ (3e47 I:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3e47i_: 3e47 I: [158005]
   Other proteins in same PDB: d3e47g_, d3e47u_
   automated match to d4eu2j_
   complexed with esy

Details for d3e47i_

PDB Entry: 3e47, 3 Å

PDB Description: Crystal Structure of the Yeast 20S Proteasome in Complex with Homobelactosin C

PDB Compounds: (I:) Proteasome component PUP3

SCOPe Domain Sequences for d3e47i_:

Sequence; same for both SEQRES and ATOM records:

>d3e47i_ d.153.1.4 (I:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d3e47i_:

• d3e47i_ first appeared in SCOP 1.75, called d3e47i1
  
• d3e47i_ appears in SCOPe 2.05
  
• d3e47i_ appears in SCOPe 2.07
  
• d3e47i_ appears in the current release, SCOPe 2.08