Lineage for d1ced__ (1ced -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (7 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (9 species) 
Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries) 
Domain d1ced__: 1ced - [15799]
Details for d1ced__
PDB Entry: 1ced (more details)
PDB Description: the structure of cytochrome c6 from monoraphidium braunii, nmr, minimized average structure
SCOP Domain Sequences for d1ced__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ced__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw
SCOP Domain Coordinates for d1ced__:
Click to download the PDB-style file with coordinates for d1ced__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ced__:
- d1ced__ first appeared (with stable ids) in SCOP 1.55
- d1ced__ appears in SCOP 1.57
- d1ced__ appears in SCOP 1.61
- d1ced__ appears in the current release, SCOPe 2.08, called d1ceda_
View in 3D