Lineage for d1ced__ (1ced -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1061Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species)
  7. 1079Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)
  8. 1081Domain d1ced__: 1ced - [15799]

Details for d1ced__

PDB Entry: 1ced (more details)

PDB Description: the structure of cytochrome c6 from monoraphidium braunii, nmr, minimized average structure

SCOP Domain Sequences for d1ced__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ced__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

SCOP Domain Coordinates for d1ced__:

Click to download the PDB-style file with coordinates for d1ced__.
(The format of our PDB-style files is described here.)

Timeline for d1ced__: