Class a: All alpha proteins [46456] (289 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
Protein RNA polymerase omega subunit [63564] (3 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries) |
Domain d3dxjo_: 3dxj O: [157932] Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxjf1, d3dxjf2, d3dxjf3, d3dxjm_, d3dxjn_, d3dxjp1, d3dxjp2, d3dxjp3 automated match to d1i6ve_ protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn |
PDB Entry: 3dxj (more details), 3 Å
SCOPe Domain Sequences for d3dxjo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxjo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d3dxjo_: