Lineage for d3dugf1 (3dug F:4-56,F:360-398)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810549Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)
  6. 1810564Protein Zn-dependent arginine carboxypeptidase [159343] (1 species)
  7. 1810565Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries)
  8. 1810579Domain d3dugf1: 3dug F:4-56,F:360-398 [157876]
    Other proteins in same PDB: d3duga2, d3dugb2, d3dugc2, d3dugd2, d3duge2, d3dugf2, d3dugg2, d3dugh2
    automatically matched to 3BE7 A:3-56,A:360-400
    complexed with arg, gol, zn

Details for d3dugf1

PDB Entry: 3dug (more details), 2.62 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase complexed with zinc
PDB Compounds: (F:) Zn-dependent arginine carboxypeptidase

SCOPe Domain Sequences for d3dugf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dugf1 b.92.1.9 (F:4-56,F:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegf
dadivgvienplanirtleevafvmkegkvykr

SCOPe Domain Coordinates for d3dugf1:

Click to download the PDB-style file with coordinates for d3dugf1.
(The format of our PDB-style files is described here.)

Timeline for d3dugf1: