Lineage for d3mdsa1 (3mds A:1-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690176Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2690317Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)
  8. 2690318Domain d3mdsa1: 3mds A:1-92 [15778]
    Other proteins in same PDB: d3mdsa2, d3mdsb2
    complexed with mn3

Details for d3mdsa1

PDB Entry: 3mds (more details), 1.8 Å

PDB Description: maganese superoxide dismutase from thermus thermophilus
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d3mdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdsa1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

SCOPe Domain Coordinates for d3mdsa1:

Click to download the PDB-style file with coordinates for d3mdsa1.
(The format of our PDB-style files is described here.)

Timeline for d3mdsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdsa2