Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries) |
Domain d3mdsa1: 3mds A:1-92 [15778] Other proteins in same PDB: d3mdsa2, d3mdsb2 complexed with mn3 |
PDB Entry: 3mds (more details), 1.8 Å
SCOPe Domain Sequences for d3mdsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdsa1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr hlaalpqdiqtavrnnggghlnhslfwrlltp
Timeline for d3mdsa1: