Lineage for d3dhzb_ (3dhz B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085170Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1085320Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 1085333Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 1085337Domain d3dhzb_: 3dhz B: [157742]
    automated match to d1oquc_
    complexed with fe2

Details for d3dhzb_

PDB Entry: 3dhz (more details), 1.63 Å

PDB Description: apo (iron free) structure of c. ammoniagenes r2 protein
PDB Compounds: (B:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d3dhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhzb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOPe Domain Coordinates for d3dhzb_:

Click to download the PDB-style file with coordinates for d3dhzb_.
(The format of our PDB-style files is described here.)

Timeline for d3dhzb_: