SCOP 1.59: Domain d1vewb1: 1vew B:1-90

Lineage for d1vewb1 (1vew B:1-90)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (4 species)

7. Species Escherichia coli [TaxId:562] [46620] (8 PDB entries)

8. Domain d1vewb1: 1vew B:1-90 [15767]
   Other proteins in same PDB: d1vewa2, d1vewb2, d1vewc2, d1vewd2

Details for d1vewb1

PDB Entry: 1vew, 2.1 Å

PDB Description: manganese superoxide dismutase from escherichia coli

SCOP Domain Sequences for d1vewb1:

Sequence; same for both SEQRES and ATOM records:

>d1vewb1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

Timeline for d1vewb1:

• d1vewb1 first appeared (with stable ids) in SCOP 1.55
  
• d1vewb1 appears in SCOP 1.57
  
• d1vewb1 appears in SCOP 1.61
  
• d1vewb1 appears in the current release, SCOPe 2.08