SCOP 1.75: Domain d3d62a1: 3d62 A:3-301

Lineage for d3d62a1 (3d62 A:3-301)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries)

8. Domain d3d62a1: 3d62 A:3-301 [157411]
   automatically matched to d1q2wb_
   complexed with 959

Details for d3d62a1

PDB Entry: 3d62, 2.7 Å

PDB Description: development of broad-spectrum halomethyl ketone inhibitors against coronavirus main protease 3clpro

PDB Compounds: (A:) 3C-like proteinase

SCOP Domain Sequences for d3d62a1:

Sequence; same for both SEQRES and ATOM records:

>d3d62a1 b.47.1.4 (A:3-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

Timeline for d3d62a1:

• d3d62a1 is new in SCOP 1.75
  
• d3d62a1 is called d3d62a_ in SCOPe 2.01
  
• d3d62a1 appears in the current release, SCOPe 2.08, called d3d62a_