SCOP 1.65: Domain d1bsna1: 1bsn A:87-138

Lineage for d1bsna1 (1bsn A:87-138)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (1 family)

5. Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (2 species)
   delta subunit in mitochondria
   this domain unfolds when bound to the gamma subunit

7. Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)

8. Domain d1bsna1: 1bsn A:87-138 [15719]
   Other proteins in same PDB: d1bsna2

Details for d1bsna1

PDB Entry: 1bsn

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex

SCOP Domain Sequences for d1bsna1:

Sequence; same for both SEQRES and ATOM records:

>d1bsna1 a.2.10.1 (A:87-138) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkkam

Timeline for d1bsna1:

• d1bsna1 first appeared (with stable ids) in SCOP 1.55
  
• d1bsna1 appears in SCOP 1.63
  
• d1bsna1 appears in SCOP 1.67
  
• d1bsna1 appears in the current release, SCOPe 2.08