Lineage for d1fxkb_ (1fxk B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077552Superfamily a.2.5: Prefoldin [46579] (1 family) (S)
  5. 1077553Family a.2.5.1: Prefoldin [46580] (2 proteins)
    contains one or two beta-hairpins at the tip of alpha-hairpin
  6. 1077557Protein Prefoldin beta subunit [46583] (1 species)
  7. 1077558Species Methanobacterium thermoautotrophicum [TaxId:145262] [46584] (1 PDB entry)
  8. 1077560Domain d1fxkb_: 1fxk B: [15704]
    Other proteins in same PDB: d1fxkc_

Details for d1fxkb_

PDB Entry: 1fxk (more details), 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).
PDB Compounds: (B:) prefoldin

SCOPe Domain Sequences for d1fxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxkb_ a.2.5.1 (B:) Prefoldin beta subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
nvqhqlaqfqqlqqqaqaisvqkqtvemqinetqkaleelsraaddaevykssgnilirv
akdelteelqekletlqlrektierqeervmkklqemqvniqeamkgag

SCOPe Domain Coordinates for d1fxkb_:

Click to download the PDB-style file with coordinates for d1fxkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fxkb_: