SCOPe 2.04: Domain d1fxka_: 1fxk A:

Lineage for d1fxka_ (1fxk A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.5: Prefoldin [46579] (1 family)

5. Family a.2.5.1: Prefoldin [46580] (2 proteins)
   contains one or two beta-hairpins at the tip of alpha-hairpin

6. Protein Prefoldin beta subunit [46583] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [46584] (1 PDB entry)

8. Domain d1fxka_: 1fxk A: [15703]
   Other proteins in same PDB: d1fxkc_

Details for d1fxka_

PDB Entry: 1fxk, 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).

PDB Compounds: (A:) prefoldin

SCOPe Domain Sequences for d1fxka_:

Sequence; same for both SEQRES and ATOM records:

>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qnvqhqlaqfqqlqqqaqaisvqkqtvemqinetqkaleelsraaddaevykssgnilir
vakdelteelqekletlqlrektierqeervmkklqemqvniqeamk

Timeline for d1fxka_:

• d1fxka_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxka_ appears in SCOPe 2.03
  
• d1fxka_ appears in SCOPe 2.05
  
• d1fxka_ appears in the current release, SCOPe 2.08