SCOPe 2.04: Domain d1fxkc_: 1fxk C:

Lineage for d1fxkc_ (1fxk C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.5: Prefoldin [46579] (1 family)

5. Family a.2.5.1: Prefoldin [46580] (2 proteins)
   contains one or two beta-hairpins at the tip of alpha-hairpin

6. Protein Prefoldin alpha subunit [46581] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [46582] (1 PDB entry)

8. Domain d1fxkc_: 1fxk C: [15702]
   Other proteins in same PDB: d1fxka_, d1fxkb_

Details for d1fxkc_

PDB Entry: 1fxk, 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).

PDB Compounds: (C:) protein (prefoldin)

SCOPe Domain Sequences for d1fxkc_:

Sequence; same for both SEQRES and ATOM records:

>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aalaeivaqlniyqsqveliqqqmeavratiseleilektlsdiqgkdgsetlvpvgags
fikaelkdtsevimsvgagvaikknfedamesiksqknelestlqkmgenlraitdimmk
lspqaeellaava

Timeline for d1fxkc_:

• d1fxkc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxkc_ appears in SCOPe 2.03
  
• d1fxkc_ appears in SCOPe 2.05
  
• d1fxkc_ appears in the current release, SCOPe 2.08