Lineage for d1fxka_ (1fxk A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904262Superfamily a.2.5: Prefoldin [46579] (1 family) (S)
  5. 904263Family a.2.5.1: Prefoldin [46580] (2 proteins)
    contains one or two beta-hairpins at the tip of alpha-hairpin
  6. 904267Protein Prefoldin beta subunit [46583] (1 species)
  7. 904268Species Methanobacterium thermoautotrophicum [TaxId:145262] [46584] (1 PDB entry)
  8. 904269Domain d1fxka_: 1fxk A: [15703]
    Other proteins in same PDB: d1fxkc_

Details for d1fxka_

PDB Entry: 1fxk (more details), 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).
PDB Compounds: (A:) prefoldin

SCOPe Domain Sequences for d1fxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qnvqhqlaqfqqlqqqaqaisvqkqtvemqinetqkaleelsraaddaevykssgnilir
vakdelteelqekletlqlrektierqeervmkklqemqvniqeamk

SCOPe Domain Coordinates for d1fxka_:

Click to download the PDB-style file with coordinates for d1fxka_.
(The format of our PDB-style files is described here.)

Timeline for d1fxka_: