Lineage for d1xbla_ (1xbl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979943Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1979944Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 1979958Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species)
  7. 1979959Species Escherichia coli [TaxId:562] [46572] (3 PDB entries)
  8. 1979960Domain d1xbla_: 1xbl A: [15697]

Details for d1xbla_

PDB Entry: 1xbl (more details)

PDB Description: nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
PDB Compounds: (A:) dnaj

SCOPe Domain Sequences for d1xbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeq

SCOPe Domain Coordinates for d1xbla_:

Click to download the PDB-style file with coordinates for d1xbla_.
(The format of our PDB-style files is described here.)

Timeline for d1xbla_: