Lineage for d3cjrb1 (3cjr B:71-137)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984852Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1984853Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1984854Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1984945Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 1984946Domain d3cjrb1: 3cjr B:71-137 [156712]
    Other proteins in same PDB: d3cjra1, d3cjrb2
    protein/RNA complex; complexed with sfg

Details for d3cjrb1

PDB Entry: 3cjr (more details), 2.05 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin.
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjrb1:

Sequence, based on SEQRES records: (download)

>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiags
arsmgve

Sequence, based on observed residues (ATOM records): (download)

>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgve

SCOPe Domain Coordinates for d3cjrb1:

Click to download the PDB-style file with coordinates for d3cjrb1.
(The format of our PDB-style files is described here.)

Timeline for d3cjrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cjrb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3cjra1