Lineage for d3cirm3 (3cir M:226-357)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940476Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1940477Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1940478Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1940517Protein Fumarate reductase [56429] (2 species)
  7. 1940518Species Escherichia coli [TaxId:562] [56430] (5 PDB entries)
  8. 1940528Domain d3cirm3: 3cir M:226-357 [156688]
    Other proteins in same PDB: d3cira1, d3cira2, d3cirb1, d3cirb2, d3circ1, d3cird1, d3cirm1, d3cirm2, d3cirn1, d3cirn2, d3ciro1, d3cirp1
    automatically matched to d1kf6a3
    complexed with f3s, fad, fes, sf4; mutant

Details for d3cirm3

PDB Entry: 3cir (more details), 3.65 Å

PDB Description: e. coli quinol fumarate reductase frda t234a mutation
PDB Compounds: (M:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d3cirm3:

Sequence, based on SEQRES records: (download)

>d3cirm3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhpaglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

Sequence, based on observed residues (ATOM records): (download)

>d3cirm3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhpaglpgsgilmtegcrdkvsqafwhewrkgntiskklheficelakaypvrpt
ahyt

SCOPe Domain Coordinates for d3cirm3:

Click to download the PDB-style file with coordinates for d3cirm3.
(The format of our PDB-style files is described here.)

Timeline for d3cirm3: