Lineage for d1liab_ (1lia B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302490Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 2302501Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88514] (1 PDB entry)
  8. 2302502Domain d1liab_: 1lia B: [15662]
    Other proteins in same PDB: d1liaa_, d1liak_
    complexed with cyc, pub

Details for d1liab_

PDB Entry: 1lia (more details), 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution
PDB Compounds: (B:) r-phycoerythrin

SCOPe Domain Sequences for d1liab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liab_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mldafsrvvvnsdskaayvsgsdlqalktfindgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnstvravsimkaaavcfisntasqrkveviegdcsalasevasycdrvvaavs

SCOPe Domain Coordinates for d1liab_:

Click to download the PDB-style file with coordinates for d1liab_.
(The format of our PDB-style files is described here.)

Timeline for d1liab_: