Lineage for d1b33l_ (1b33 L:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 149061Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 149062Protein Allophycocyanin [46537] (2 species)
  7. 149063Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [46539] (1 PDB entry)
  8. 149074Domain d1b33l_: 1b33 L: [15659]
    Other proteins in same PDB: d1b33n_, d1b33o_

Details for d1b33l_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8

SCOP Domain Sequences for d1b33l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33l_ a.1.1.3 (L:) Allophycocyanin {Cyanobacterium (Mastigocladus laminosus)}
sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
pidavaagvsamknvassilsaedaaeagayfdyvagala

SCOP Domain Coordinates for d1b33l_:

Click to download the PDB-style file with coordinates for d1b33l_.
(The format of our PDB-style files is described here.)

Timeline for d1b33l_: