SCOP 1.75: Domain d3cf5a2: 3cf5 A:33-127

Lineage for d3cf5a2 (3cf5 A:33-127)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Deinococcus radiodurans [TaxId:1299] [159085] (5 PDB entries)
   Uniprot Q9RXJ9 33-127

8. Domain d3cf5a2: 3cf5 A:33-127 [156539]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR A:33-127
   complexed with mg, txx

Details for d3cf5a2

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (A:) 50S ribosomal protein L2

SCOP Domain Sequences for d3cf5a2:

Sequence; same for both SEQRES and ATOM records:

>d3cf5a2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
ltealpktggrnnrgritsrfiggghkrlyriidfkrrdksgvnakvaaieydpnrsari
allhyadgekryilapegltvgatvnagpeaepkl

Timeline for d3cf5a2:

• d3cf5a2 is new in SCOP 1.75
  
• d3cf5a2 appears in SCOPe 2.01
  
• d3cf5a2 appears in the current release, SCOPe 2.08