SCOP 1.75: Domain d3cf5o1: 3cf5 O:5-98

Lineage for d3cf5o1 (3cf5 O:5-98)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
   Uniprot Q9RY64 5-98

8. Domain d3cf5o1: 3cf5 O:5-98 [156555]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR O:5-98
   complexed with mg, txx

Details for d3cf5o1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (O:) 50S ribosomal protein L21

SCOP Domain Sequences for d3cf5o1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5o1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d3cf5o1:

• d3cf5o1 is new in SCOP 1.75
  
• d3cf5o1 appears in SCOPe 2.01
  
• d3cf5o1 appears in the current release, SCOPe 2.08