Lineage for d3cd6w1 (3cd6 W:1-154)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269796Domain d3cd6w1: 3cd6 W:1-154 [156496]
    Other proteins in same PDB: d3cd621, d3cd6b1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6p1, d3cd6r1, d3cd6s1, d3cd6y1, d3cd6z1
    automatically matched to d1w2bv_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd6w1

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d3cd6w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cd6w1 i.1.1.2 (W:1-154) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d3cd6w1:

Click to download the PDB-style file with coordinates for d3cd6w1.
(The format of our PDB-style files is described here.)

Timeline for d3cd6w1: